A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10123 |
| Swiss-prot Accession number | Q95J85 (Sequence in FASTA format) |
| Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
| Source organism | Monodelphis domestica (Short-tailed gray opossum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Protein Length | 141 Amino acids |
| Molecular weight | 15032 |
| References | 1 Kacsoh B.; "Cloning of a cDNA encoding the luteinizing hormone beta chainprecursor in the marsupial, Monodelphis domestica."; Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | GAGSFRPLCRPTNATLAAESDACPVCVTFTTTICAGYCPSMVRVLPAALPPGPQLVCTYRELTFSWIRLPGCPPGVDPIFSFPVALSCACGSCRLSHSDCGGPRARPHLCTRPHLSLRLL |
| Position of mature hormone in Pre-Hormone protein | 120 Residues from position (22-141) |
| Receptor | N/A |
| Gene ID | 497247 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10154 |
| Swiss-prot Accession number | Q9GL60 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Monodelphis domestica (Short-tailed gray opossum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
| Protein Length | 215 Amino acids |
| Molecular weight | 24384 |
| References | 1 Kacsoh B.; "Cloning and characterization of pituitary growth hormone precursorcDNA from the marsupial, Monodelphis domestica."; Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | FPAMPLSSLFANAVLRAQHLHQLVADTYKEFERTYIPEAQRHSIQSTQTAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLSPVQFLSRVFTNSLVFGTSDRVYEKLRDLEEGIQALMQELEDGSSRGGLVLKTTYDKFDTNLRSDEALLKNYGLLSCFKKDLHKAETYLRVMECRRFVESSCAF |
| Position of mature hormone in Pre-Hormone protein | 190 Residues from position (26-215) |
| Receptor | N/A |
| Gene ID | 554243 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10205 |
| Swiss-prot Accession number | Q95J82 (Sequence in FASTA format) |
| Description | Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain). |
| Source organism | Monodelphis domestica (Short-tailed gray opossum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Protein Length | 129 Amino acids |
| Molecular weight | 14737 |
| References | 1 Kacsoh B.; "Cloning and characterization of the cDNA encoding pituitary follicle-stimulating hormone beta (FSH-beta) precursor in the marsupial,Monodelphis domestica."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases.
2 Kacsoh B.; "Cloning and characterization of the cDNA encoding pituitary follicle-stimulating hormone beta (FSH-beta) precursor in the marsupial,Monodelphis domestica."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Cys_knot |
| Hormone Name | Follicle-stimulating hormone beta subunit |
| Mature Hormone Sequence | CVLTNITISVEREECEFCISINTTWCSGYCHTRDLVYKEPIRPNIQKACTFREFVYETMSLPGCANQADSLYSYPVATACHCGSCDTDSTDCTVRGLGPSYCSFNERKE |
| Position of mature hormone in Pre-Hormone protein | 109 Residues from position (21-129) |
| Receptor | N/A |
| Gene ID | 554190 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10220 |
| Swiss-prot Accession number | Q6YNX4 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Monodelphis domestica (Short-tailed gray opossum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13513 |
| References | 1 Kacsoh B.; "Cloning and characterization of the cDNA encoding the anteriorpituitary glycoprotein hormone common alpha subunit in the marsupial,Monodelphis domestica."; Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.
2 Kacsoh B.; "Cloning and characterization of the cDNA encoding the anteriorpituitary glycoprotein hormone common alpha subunit in the marsupial,Monodelphis domestica."; Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFIMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | N/A |
| Gene ID | 554198 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10779 |
| Swiss-prot Accession number | Q95J88 (Sequence in FASTA format) |
| Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
| Source organism | Monodelphis domestica (Short-tailed gray opossum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Indispensable for the control of thyroid structure and metabolism |
| Protein Length | 138 Amino acids |
| Molecular weight | 15398 |
| References | 1 Kacsoh B.; "Cloning and characterization of the cDNA encoding pituitary thyroidstimulating hormone (TSH, thyrotropin) beta of the marsupial,Monodelphis domestica."; Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Cys_knot |
| Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
| Mature Hormone Sequence | LCVPTGYTMHIERRECAYCLTINTTICAGYCMTRDSNGKLFLPKSALSQDVCTYRDVIYRTVVMPGCPPHVIPYISYPVAVSCRCGKCNTDYIDCIHESVTTNYCTKPQKPY |
| Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
| Receptor | N/A |
| Gene ID | 503501 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 11021 |
| Swiss-prot Accession number | O62819 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Monodelphis domestica (Short-tailed gray opossum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Prolactin acts primarily on the mammary gland by promoting lactation |
| Protein Length | 228 Amino acids |
| Molecular weight | 26071 |
| References | 1 Kacsoh B., Soos G.; "Cloning and characterization of pituitary prolactin cDNA from themarsupial Monodelphis domestica."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | LPICPSGAVNCQVSLSDLFDRAVMLSHYIHSPSSEMFNEFDERYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIRHEDLLNLVLRVLRSWSEPLYHLVTEVRSMQEAPDTILLKAMEIEEQNKRLLEGMEKIVGQVHPGDRENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDSNC |
| Position of mature hormone in Pre-Hormone protein | 199 Residues from position (30-228) |
| Receptor | N/A |
| Gene ID | 100017831 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |